PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG254400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 544aa    MW: 60185.8 Da    PI: 5.9192
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG254400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.55.2e-1311735421373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++++++c +av+++d  +++ l+++l +l+s +gdpmqRl ay++e++ arl++s+s lyk+l+++e +   sse +++++l++e++P+
  Pavir.9KG254400.2.p 173 LKQVIIACGKAVAENDVFATDLLISELGQLVSVSGDPMQRLGAYMLEGIVARLSSSGSMLYKSLKCKEPT---SSELMSYMHLLYEICPF 259
                          57899****************************************************************9...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +kf++l aN aI ea++ge+ vH+iDf+i qG QW++L+qaLa+Rp+gpp ++iTg+++++s   +   l  +g+rL+++A+++g+pfef
  Pavir.9KG254400.2.p 260 FKFGYLSANGAIAEAIKGENFVHVIDFQIAQGSQWITLIQALAARPGGPPYIKITGIDDSNSAyaRGGGLDIVGRRLHSVAQSCGLPFEF 349
                          ***********************************************************988899999********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ v  + ++++l +L+++pgE +aVn+++qlh+++desvs+e++rd++++++ks++P+vv++veqe+++n+++F+ r +e+l+yy+a+f
  Pavir.9KG254400.2.p 350 NA-VPAASHEVQLGHLALRPGEIIAVNFAYQLHHVPDESVSMENHRDRIIRMIKSINPRVVTLVEQESNTNTAPFFPRYMETLNYYTAMF 438
                          **.7999*********************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +s+++ lpr+++ r++ E+++++r+ivn++acegaer+erhe ++kW++r+ +aGF+p+pls+ +++++++llr ++s  yr+ee+ g l
  Pavir.9KG254400.2.p 439 ESIDVALPRDDRRRMSAEQHCVARDIVNLIACEGAERVERHELFGKWKARFAMAGFRPYPLSSVVNNTINTLLRSYNSC-YRLEESGGVL 527
                          *****************************************************************************55.********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          +lgWk+r Lv+ SaW
  Pavir.9KG254400.2.p 528 YLGWKNRVLVVSSAW 542
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.292147524IPR005202Transcription factor GRAS
PfamPF035141.8E-128173542IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MPSGASNRRP YKISEDSQMP YYNNSATVEE NDRLHVMQNN LDHHHSSPDD ESQKINSSNT  60
QIFEAQYCTL ESSSANGVYP AQSSTSSHSI SPLSGSPLSQ HDSHSDHTYS SPPSASCLTE  120
VADLQIKLKE LENAILGPEL DITSDRPESF LQANVQLRPD NWRQLLGIDA GDLKQVIIAC  180
GKAVAENDVF ATDLLISELG QLVSVSGDPM QRLGAYMLEG IVARLSSSGS MLYKSLKCKE  240
PTSSELMSYM HLLYEICPFF KFGYLSANGA IAEAIKGENF VHVIDFQIAQ GSQWITLIQA  300
LAARPGGPPY IKITGIDDSN SAYARGGGLD IVGRRLHSVA QSCGLPFEFN AVPAASHEVQ  360
LGHLALRPGE IIAVNFAYQL HHVPDESVSM ENHRDRIIRM IKSINPRVVT LVEQESNTNT  420
APFFPRYMET LNYYTAMFES IDVALPRDDR RRMSAEQHCV ARDIVNLIAC EGAERVERHE  480
LFGKWKARFA MAGFRPYPLS SVVNNTINTL LRSYNSCYRL EESGGVLYLG WKNRVLVVSS  540
AWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-591755426374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.216170.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587660.0HQ858766.1 Zea mays clone UT1682 GRAS transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983228.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_004983229.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK4A8460.0K4A846_SETIT; Uncharacterized protein
STRINGSi035052m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein